General Information

  • ID:  hor005592
  • Uniprot ID:  A1Z0M0
  • Protein name:  Hepcidin
  • Gene name:  hamp
  • Organism:  Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea)
  • Family:  Hepcidin family
  • Source:  animal
  • Expression:  Expressed in all tissues tested, with highest levels of expression in kidney and lowest levels in liver. Intra-peritoneal injection of lipopolysaccharide results in increased expression in heart, spleen and stomach, but not in kidney or liver.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Larimichthys (genus), Sciaenidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006879 intracellular iron ion homeostasis; GO:0007165 signal transduction; GO:0042742 defense response to bacterium; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0050832 defense response to fungus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RCRFCCRCCPRMRGCGICCRF
  • Length:  21
  • Propeptide:  MKTFSVAVAVAVVLAFICLQESSAVPANEEQELEQQIYFADPEMPVESCKMPYYMRENRQGSPARCRFCCRCCPRMRGCGICCRF
  • Signal peptide:  MKTFSVAVAVAVVLAFICLQESSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages.Has very strong antibacterial activity against the marine Gram-negative bacteria V.alginolyticus (MIC=24 ¦ÌM), V.fluvialis, V.harveyis (MIC=12 ¦ÌM) and V.parahaemolyticus (MIC=6 ¦ÌM). Has antibacterial activity against the Gram-negative bacteria A.hydrophila (MIC=6 ¦ÌM), E.coli (MIC=24 ¦ÌM), and E.coli BL21(DE3)plysS (MIC=6 ¦ÌM), and the Gram-positive bacteria B.cereus (MIC=24 ¦ÌM), B.subtilis (MIC=6 ¦ÌM), C.glutamicum (MIC=3 ¦ÌM), M.luteus (MIC=3 ¦ÌM), M.lysodeikticus, S.aureus (MIC=6 ¦ÌM) and S.epidermis (MIC=12 ¦ÌM). Possesses antifungal activity against A.niger (MIC=24 ¦ÌM), F.graminearum (MIC24 ¦ÌM) and F.solani (MIC=24 ¦ÌM), but lacks antifungal activity against the yeasts P.pastoris GS115
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-19; 5-8; 6-15; 9-18
  • Structure ID:  AF-Q8UW81-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005592_AF2.pdbhor005592_ESM.pdb

Physical Information

Mass: 288710 Formula: C98H165N39O22S9
Absent amino acids: ADEHKLNQSTVWY Common amino acids: C
pI: 8.81 Basic residues: 6
Polar residues: 10 Hydrophobic residues: 3
Hydrophobicity: 12.38 Boman Index: -6417
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 18.57
Instability Index: 342.86 Extinction Coefficient cystines: 500
Absorbance 280nm: 25

Literature

  • PubMed ID:  19150638
  • Title:  Cloning and expression of a hepcidin gene from a marine fish (Pseudosciaena crocea) and the antimicrobial activity of its synthetic peptide.
  • PubMed ID:  19344770
  • Title:  Isolation and characterization of a hepcidin peptide from the head kidney of large yellow croaker, Pseudosciaena crocea.